SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00234.2|PACid:22048388 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_007_00234.2|PACid:22048388
Domain Number - Region: 182-205,234-275
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000824
Family WD40-repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00234.2|PACid:22048388
Sequence length 303
Sequence
MICSSNDVAFPIPEDFSLSYLGNPVVHVVGSSNGYLLSSHEQECPMSYVISSPITKQQII
LPIPNKTSKIVCHGFQCDAYGKHYKIVRTISLRPLALNTGLTVEVLSSDMPNQWKLFILT
CPFRFSLNFSFRSTTMIRNDVAYLPAFVEQATLEPCLLIFDQSKEILEVVEVPKERCNLF
GMSDGLILCASNELGQLKIWLLNDKGDAKREWFLKHNVGLGSKVENYFECTKDADEGIIE
LIAFHPMNPRVLFIACAQNIYQYNVSDSRFELICDFTKKDWNRVYTFIPYTSPLIGPQLF
CDH
Download sequence
Identical sequences A0A2G5EJ33
Aquca_007_00234.2|PACid:22048388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]