SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00245.1|PACid:22048290 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00245.1|PACid:22048290
Domain Number 1 Region: 83-406
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 1.08e-79
Family Catechol oxidase 0.000000352
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00245.1|PACid:22048290
Sequence length 584
Sequence
MDPKKWVLAALLIFILIGLSSNLFPRDSNNMQYTLKGQVKNMIISMVTAVSWLSSSGEVT
TASNQNKKPGHVVLSPNLTSCHGSLTDGDRPIYCCPPKRESEERFIDFQFPDSSSPIRIR
SPAHLVDKEYIAKYNKALTIMKSLPYEDPRSFLRQAHVHCIFCSGAYNQLHTNFLLKIHR
SWLFFPWHRMMLYFHERILGSLIGDDTFALPFWNWDNPEGMFIPDMYMNGSFLDSQRERS
HLPPQVADINFDYVERGLDPEDQIEANVAFMYHQMVSGAKKTELFMGCPYKSGEEGFCDG
PGTIELAPHNALHTWVGNTQNPEYENLGAFYSAAKDPVFYAHHSNIDRLWDVWRGFRGNS
DINDPDWLDSYFYFYDENAQNIRIRIRDVLDTTKLRYAYERTDNSWLNARPKPSVPPKIA
RHILKMRDIQNKLQSPNQISSPDFGPQGHTLDTTLRVRVPRPKTHRTKKEKEEEEEVLVI
YGIEVKKDVYVKFDVFVNAVDETTIGPESREFAGTFVNMRRGVRIVMNKNDVATKRKTIL
KLGISELLEDLEADGDESIWVTLVPRGGTCINTTVDGVKIEYMQ
Download sequence
Identical sequences A0A2G5EJL9
Aquca_007_00245.1|PACid:22048290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]