SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00334.1|PACid:22048562 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00334.1|PACid:22048562
Domain Number 1 Region: 4-168,196-315
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.86e-74
Family WD40-repeat 0.0000486
Further Details:      
 
Domain Number 2 Region: 245-402,459-578
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 2.79e-18
Family DPP6 N-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00334.1|PACid:22048562
Sequence length 1216
Sequence
MLTKFETKSNRVKGLSFHPKRPWILASLHSGVIQLWDYRMGTLIDRFDEHDGPVRGVHFH
KSQPLFVSGGDDYKIKVWNYKMHRCLFTLLGHLDYIRTVQFHHEYPWIVSASDDQTIRIW
NWQSRTCVSVLTGHNHYVMCATFHPKEDLVVSASLDQTVRVWDIGALRKKTVSPADDLLR
LSQMNTDLFGGVDAVVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQLKLWRMNDTKAWE
VDTLRGHMNNVSCVMFHAKQDIIVSNSEDKSIRVWDVTKRTCVQTFRREHDRFWILASHP
EMNLLAAGHDSGMIVFKLERERPAFSVSGDVLYYVKDRFLRFYEFSTQKDSQVIPIRRPG
TTSLNQSPRTLSYSPSENAVLVCSDVDGGSYELYTIPKDSISRGDTVQDAKRGVGGSAVF
VARNRFAVLDKSNNQVLVKNLKNEIVKKSILPIVAEAIFYAGTGNLLCRAEDRVVIFDLQ
QRLVLGDLQTPFIKYVVWSNDMESIALLSKHSIVIASKKLVHRCTLHETIRVKSGAWDDN
GVFIYTTLNHVKYCLPNGDSGIIKTLDVPIYITKISGNTIFCLDRDGKNRAVIIDATEYV
FKLSLLKKKYDQVMSIIRNSQLCGQAMIAYLQQKGFPEVALHFVKDERTRFNLALESGNI
QIAVASANAIDEKDHWYRLGVEALRQGNAGIVEYAYQRTKNFDRLSFLYLVTGNTSKLSK
MLKIAELKNDVMGQFHNALYLGDIHERVKILENVGHLPLAYMTATVHGLNDVAERLAAKL
GDNVPSLPQGKVSSLLMPPTPILCGGDWPLLRVMKGIFEGGLENIGRGVQEEDEEAADAD
WGEELDIVDGEVVQNGDVGAVEDGEANDENDEEGGWDLEDLELPPEVDTPKVSNARSSVF
VTPTPGMPVSQIWIQKSSLAGEHAAAGNFDTAMRLLSRQLGIQNFAPLKPMFLDLYTGSH
SYLRAFSSSPIILLAVERGWSETSSPNVRGPPALVFSFSQLDEKLKAGHKATSGGKFTEA
LRIFKGILHTIPLIVVESRREVDEVRELIFKAKEYVVGLQMEIRRKELRDDPVRQQELAA
YFTHCNLHMTHLRLALMNAMSICYKAKNLSTAANFARRVLETNPSIENQAKTARQVLQSA
ERNMRDETQLNYDFRNPFVVCGATYVPIYQGQKDVACPYCGSRFVPSQQGQLCTVCDLSV
VGSDASGLLCSPSQIR
Download sequence
Identical sequences A0A2G5EJK1
Aquca_007_00334.1|PACid:22048562 Aquca_007_00334.2|PACid:22048561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]