SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00457.2|PACid:22049129 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00457.2|PACid:22049129
Domain Number 1 Region: 36-66,100-146,205-421,454-497
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.08e-35
Family WD40-repeat 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00457.2|PACid:22049129
Sequence length 501
Sequence
MTPVSNGDVGIPPSLEWKFSQVFGERAAGEEVQEVDIISAIEFDKTGEHLATGDRGGRVV
LFERTDGKDHTIRKDLEKKDYLVSRQPEFRYKTEFQSHEPEFDYLKSLEIEEKINKVRWC
QTANGALFLLSTNDKTVKYWKVQEKKIKKICEMNIDSPDTASNGRSAGQNGAASDFVFPP
GGFPSLRLPLVVVLNIVGHETNLVPRCRRVYAHAHDYHINSISNNSDGETFISADDLRIN
LWNLEICNQSFNIVDVKPVNMEDLTEVITSAEFHPTHCNTLAYSSSKGTIRLIDMRQSAL
CDTHAKIFEEHDTSGSRSFFTEIIASISDIKFGNDGRHILSRDYMTLKLWDLNMESSPVA
TFQVHEYLRPKLCDLYENDSIFDKFECCISGDGLRVATGSYSNLFRVFGCVPGSTEARTL
EASKNPSRRQVQTPSKPSRSFTNLARSRRRGAENLNGDANGGSYDFSTKLLHLAWHPTSN
ALACAAANSLYMYNADDTPPE
Download sequence
Identical sequences A0A2G5EK18
Aquca_007_00457.2|PACid:22049129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]