SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00469.1|PACid:22047618 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00469.1|PACid:22047618
Domain Number 1 Region: 3-98
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.71e-25
Family B3 DNA binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 188-278
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.41e-21
Family B3 DNA binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00469.1|PACid:22047618
Sequence length 285
Sequence
MEAKRRHFFRVMIDDFDRRLRIPQAFLQSITKQSSEMVILESPSGSRWRVRLKRTSDGMY
LEDGWGKFARAHSLEKGEFLVFRYDGNTKFTVQIFDSSTLEKEDAFKVVNSQEEIKCDRG
KKRMRPPEVKRKNHLEPWNKSMRLCNPTQITKRHQEDPLLERKGPHQSRRSNSLGNTLVK
HGPMQAGRNPFFKVVLRPSYIHILPIPTRFARRYIKTEDEIVTIMVPDGRTWHIRCSKAT
QGFYQLCEGWKHFKEEINLNVGNICVFEMIRARTFLLKAPRKHIA
Download sequence
Identical sequences A0A2G5EK48
Aquca_007_00469.1|PACid:22047618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]