SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00470.3|PACid:22048901 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00470.3|PACid:22048901
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-23
Family B3 DNA binding domain 0.0017
Further Details:      
 
Domain Number 2 Region: 193-290
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-16
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00470.3|PACid:22048901
Sequence length 292
Sequence
MESRKSHFFKILVEDFEQKLQIPKAFMKNISEKSSKMAILKGPSGSCWHVKLTRKTTGMY
LEDGWGSFSRAHSLSVGKFLVFGYDGNMTFTVQIFDSSTLEEESAFAVINTQEKIKCEGI
KRHGRPSKAQSNHANSCHTSVEPCSLTPNAEHHQGKSVLEQRKPHQSYRSISDKGKNYSM
EKDRAVHAAKICKPDHPFFTIGMQPSYALYGPIPRSFSRRYFSEGAGNITLMLSDGRSLN
VGYINYYTNICKMSRGWKHLLEVFDIKVGNLCVFELIRSDNLLFKVHILRDA
Download sequence
Identical sequences A0A2G5EK50
Aquca_007_00470.1|PACid:22048899 Aquca_007_00470.2|PACid:22048900 Aquca_007_00470.3|PACid:22048901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]