SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00545.1|PACid:22048827 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00545.1|PACid:22048827
Domain Number 1 Region: 442-500
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 1.77e-16
Family SPT5 KOW domain-like 0.004
Further Details:      
 
Weak hits

Sequence:  Aquca_007_00545.1|PACid:22048827
Domain Number - Region: 546-582
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00516
Family SPT5 KOW domain-like 0.077
Further Details:      
 
Domain Number - Region: 392-428
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00731
Family N-utilization substance G protein NusG, C-terminal domain 0.077
Further Details:      
 
Domain Number - Region: 214-290
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0079
Family Ribosomal proteins L24p and L21e 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00545.1|PACid:22048827
Sequence length 665
Sequence
MARRTRKRDEVVEEEEAEYDDYHHDDDDEEMTSTRNSRRNKRQRSGVSEFFDEEAIIDDD
EDEESDNGEGEYGFIDNEGDDDELPDEDGDPGRYRMQHHQRFLPSERDKELDVEQLERNV
RERFGSLLSDDGEDFYSDDYENEETSQVEQQALLPCIRDSKLWMVGCKTGHEREVVTYLM
QKAIDKVSESQITSAIALDHLKNYIYVEAHKEAHVKEAIKGVRNIFQKKVTLVPLKEMTD
VLSVESKAVDISKNMWVRLKIGTYKGDLAKVVDVDNVRRSLTVKLIPRIDLQALADKVIG
DKEVVKKKVIPPQRFMNIDNARDLHLRVRRSRDPNTGNYFEYIEGMRFQDGFLLKTFAMK
SISTQNIQPTLDELEKFRNPENADGDRALLGNREKGHFVEGDAVLVLIGDLKNLMGRVEK
VEEEYVHIRPKMKDMPRSLVVSKKDVCKYFKPGDHIKVVSGAREGATGMVVKVEGQFLII
VSDSTKEDIRVFADHVVESTEVASDVTLGSPAPQTPRSPKRLPRGGLPTNFGGRHRDGRG
GQGSMIGSIIKIRQGHYKGCQGRIVDINRQTVRIELESQMKVVTVNRNDISDKGAVSNPY
RETPQFRVGSETPMHPSRTPLHPYMPTPLREPGASTPVHYGMRTPMHDRAWNPAPLSPTI
VVGEK
Download sequence
Identical sequences A0A2G5EL30
Aquca_007_00545.1|PACid:22048827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]