SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00547.3|PACid:22048349 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00547.3|PACid:22048349
Domain Number 1 Region: 38-185,216-317,617-692
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.38e-46
Family WD40-repeat 0.0038
Further Details:      
 
Domain Number 2 Region: 398-478
Classification Level Classification E-value
Superfamily TPR-like 0.0000000149
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00547.3|PACid:22048349
Sequence length 754
Sequence
MEMMSYSDGNITDLLDYRNITPRYEYNQGLQMHSSLVQRLSLEKELEGHQGCVNAVAWNS
KGSLLVSGSDDTRINIWSYSSKKLLRSVETGHAANIFCTKFVPETSDELVVSGAGDAEVR
LFCVSRSGGSCLEEDVVRPSAVYQCHSRRVKKLAVEIGNPNVVWSASEDGTLRQHDFREG
NSCPPEGSSNQECRSVLLDLRSGAKKSLADPPKQCLLLKSCDISTTRPHLLLVGGSDAFA
RIYDRRMLPPMSSCQKKTKPPPCVNYFCPMHLSDRVRPSLHLTHVTFSPNGEEVLLSYSG
EHVYLMDVNHGGSDIMKYTVDDVSRQISLVPILNREEIHPSRSQVFPNGFPRKANVPAKL
KKCKELVRAAEKSLVEGRTYLYGIEACNEVLDGNIHELGPELRHDCLCIRAALLLKRKWK
NDVHMAIRDCNKARSINTSSFLGHYHMSEALMQLAKHKEALDFAFAAQCLAPSNSEAAER
VESIRGQLAAAEAEKSNKENDRASKSGTGRVRSITDILHRSEANSDASQDGPRSEREDSD
YEEEMELDFETSISGDEGHDTESSILRGNLNLKFHRRGDSGKENRSGNVSSGSPSSSSKN
ENRAYQPEAVIDMKQRYIGHCNVGTDIKQASFLGQRGEYVASGSDDGRWFIWEKRTGRLI
NMLPGDEAVVNCVQCHPFDCTIATSGIDPTIKTPSIVTGGAAGPETAAVLSVMERNQNNL
CRNREVILPLELLERFRMHEFAEGTLHPFECAQT
Download sequence
Identical sequences A0A2G5EKQ1
Aquca_007_00547.3|PACid:22048349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]