SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00554.1|PACid:22048856 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00554.1|PACid:22048856
Domain Number 1 Region: 7-241
Classification Level Classification E-value
Superfamily 14-3-3 protein 5.62e-99
Family 14-3-3 protein 0.00000000854
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00554.1|PACid:22048856
Sequence length 248
Sequence
METETLTREQYVYLAKLAEQAERYEEMVSFMEKLVVGSSSVDELTVEERNLLSVAYKNVI
GSLRAAWRIVSSIEQKEEGRKNEEHVSLVKVYRSKVESELTDVCAGILKLMDNHLIPSAT
TSESKVFYLKMKGDYHRYLAEFKSGVERKEAAEETMLAYKAAQDVAIADLAPTHPIRLGL
ALNFSVFYYEILNSSEKACSMAKEAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTS
DMDQLDDA
Download sequence
Identical sequences A0A2G5EKK7
Aquca_007_00554.1|PACid:22048856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]