SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00576.2|PACid:22048573 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00576.2|PACid:22048573
Domain Number 1 Region: 14-239
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-48
Family C-terminal domain of adrenodoxin reductase-like 0.0000117
Further Details:      
 
Domain Number 2 Region: 244-374
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000647
Family N-terminal domain of adrenodoxin reductase-like 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00576.2|PACid:22048573
Sequence length 383
Sequence
MYHVVVLAYGAESDRVLGVPGEDLEGIYSAREFVWWYNGHPDCSDLDPDLKSTDTAVILG
QGNVALDVARILLRPTTELAKTDIAEHALASLQESSIRKVYLVGRRGPVQAACTAKELRE
VLGIKDLYINILESDLSKSAADEEEMKNSRIQRRVYEILSKAARSQPSHPISGQRELHFV
FFRRPEKFLHSDDSSGRVTGVRLEKTVLKENSGSGRQSAVGTGQYEDLGCGLVLKSIGYK
SVPVDGLPFDHHKGVVPNIRGRVLSNTHTEPLIFENGLYVVGWLKRGPTGIVATNLYCAE
ETVASISEDLDQGVLTPTLPRPGREGLQQLLDSKGVRFVPFNGWEQIDLKEKSLGSLKNK
PREKITRWGELLKAANRESVTEQ
Download sequence
Identical sequences A0A2G5EKS2
Aquca_007_00576.2|PACid:22048573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]