SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00673.1|PACid:22048007 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00673.1|PACid:22048007
Domain Number 1 Region: 44-302
Classification Level Classification E-value
Superfamily Ribokinase-like 1.53e-75
Family Thiamin biosynthesis kinases 0.00000683
Further Details:      
 
Domain Number 2 Region: 326-530
Classification Level Classification E-value
Superfamily Thiamin phosphate synthase 1.7e-65
Family Thiamin phosphate synthase 0.00000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00673.1|PACid:22048007
Sequence length 538
Sequence
MQAYILNSSIPMVTIPKRSYNSIKVMAMETPPTTDGNISNPRKNIPHVLTVAGSDSGAGA
GIQADLKACGALGVYCSTVITAVTAQNTIGVQGVHPVPESFVYEQLRSVLSDMQVDVVKT
GMLPSIGVVKLLCQSLKEFPVQALVVDPVMVSTSGDILADPSILIAFREELLPMADIVTP
NLKEASALLGGMQLETIADMCSAAKSIHKLGPRCVLVKGGDLPAPVDAVDIFFDGEHCHE
LRASRIKTHNTHGTGCTLASCIAAELAKGSRMLPAVQVAKRFVETALDYSKDIEIGSGPQ
GPFDHFSKLRRSVYKSSVRRGFDPNDLLLYAITDSGMNKKWARSITDAVKAAIEGGATIV
QLREKDADTREFLELAKSCVEICHAHGVPLLINDRVDVALACDADGVHVGQSDMPPRIVR
ALLGSGKIIGVSCKTPEQALQAWADGADYIGCGGVFPTSTKANNITVGLSGLKTVCSASK
LPVVAIGGINNGNARSVMEIGTANLHGVAVVSALFDRECVSSETRKLHSMLMDVLSNK
Download sequence
Identical sequences A0A2G5EL72
Aquca_007_00673.1|PACid:22048007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]