SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00915.1|PACid:22048730 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_007_00915.1|PACid:22048730
Domain Number - Region: 11-60
Classification Level Classification E-value
Superfamily Di-copper centre-containing domain 0.0785
Family Hemocyanin middle domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00915.1|PACid:22048730
Sequence length 187
Sequence
MIIFVIVLHPENVEFHVVNASLAEFDFITNNNVNTIVYNLSIEARVRNPNKKIGYYYDRI
DGKAFYEKEQFAYIILGDHFYQGHKNNTMLHILFQGNSSIPLQGSKLEKFSKEFDKAKND
GAVKFYIRFGVRCRLKIGHYKSIYSKPKIHCYLRVPLLTNNGTSIVFFGTTCDVGFPLAR
KGDVSNV
Download sequence
Identical sequences A0A2G5EMB4
Aquca_007_00915.1|PACid:22048730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]