SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00923.1|PACid:22048961 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00923.1|PACid:22048961
Domain Number 1 Region: 16-239
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.97e-39
Family Cell cycle arrest protein BUB3 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00923.1|PACid:22048961
Sequence length 278
Sequence
MTNLFCALRGRMMATVFSGGCDKQVKMWPLLSGGQPVTIAQHDAPISELAWIPQMSLLVT
GSWDRTLKYWDTRQQNPVHTQQLPERCYALSVRHPLMVVGTADRNLIVFNLQNPQTEFKR
VVSPLKYQTRCVAAFPDQQGFLVGSIEGRVGVQHLDDAQKNKDFTFKCHREGNEIYSVNS
LNFHPVHHTFATSGSDGAFNFWDKDSKQRLKAMSRCNHPIPCSTFNNDGSIFAYAVSYDW
SKGAENHNPATAKNYIYLHLPQETEVKGKPKIGASGRK
Download sequence
Identical sequences A0A2G5EMD6
Aquca_007_00923.1|PACid:22048961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]