SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_007_00980.2|PACid:22047886 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_007_00980.2|PACid:22047886
Domain Number 1 Region: 152-201
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000513
Family WD40-repeat 0.0084
Further Details:      
 
Domain Number 2 Region: 125-149
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000502
Family CCCH zinc finger 0.0058
Further Details:      
 
Weak hits

Sequence:  Aquca_007_00980.2|PACid:22047886
Domain Number - Region: 29-51
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0816
Family CCCH zinc finger 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_007_00980.2|PACid:22047886
Sequence length 215
Sequence
MDLDNGGGKRVFTRLGGGGGGHTQSSHMEPKTCFHWRAGRCNRNPCPYLHSELPQHSNSN
VKRGYGNGLPDNNNNHNTNDRSFASQGFARRKPNNSNQQVNNKWGRGHRGSGAGGVGAFR
PPPKVQDKICHFWIDDKCSYGDKCRYLHQWFTSDSFTMLTQLPGHEKVISAIAFPMGSGK
LYSGSKDESVKVWDCQTGQVWNDFFLLSCILLPDI
Download sequence
Identical sequences A0A2G5EMQ5
Aquca_007_00980.2|PACid:22047886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]