SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_008_00079.2|PACid:22061625 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_008_00079.2|PACid:22061625
Domain Number 1 Region: 1839-2231
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.06e-104
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000349
Further Details:      
 
Domain Number 2 Region: 1513-1833
Classification Level Classification E-value
Superfamily ClpP/crotonase 9.62e-76
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000000483
Further Details:      
 
Domain Number 3 Region: 171-409
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.83e-61
Family BC ATP-binding domain-like 0.000000251
Further Details:      
 
Domain Number 4 Region: 31-170
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.06e-47
Family BC N-terminal domain-like 0.00000352
Further Details:      
 
Domain Number 5 Region: 438-551
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.15e-28
Family BC C-terminal domain-like 0.00000895
Further Details:      
 
Domain Number 6 Region: 687-757
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00000000602
Family Biotinyl/lipoyl-carrier proteins and domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_008_00079.2|PACid:22061625
Sequence length 2270
Sequence
MTEAQTSPIMANAWRGNGLLNGAIAVRNSGTLSEIDDFCYALGGKRPIHSILIANNGMAA
VKFMRSVRTWSYETFGTEKAILLVAMATPEDVRINAEHIRIADQFVEVPGGTNNNNYANV
QLIVEMAEITHVDAVWPGWGHASEIPELPDALIARGIVFLGPPASSMSALGDKIGSSLIA
QAAGVPTLPWSGSHVKIPPESCLDSIPDNIYREACVYTTEEAVASCQVVGYPAMIKASWG
GGGKGIRKVHNDDEVKALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDQHGNVAALHS
RDCSVQRRHQKIIEEGPITVAPLEVVKELEQAARRLAKCVNYVGAATVEYLYSMDTGEYF
FLELNPRLQVEHPVTEWIAEINLPAAQVAVGMGIPLWQIPEIRRFYGKDHNGGYDAWKRT
SLVATPFDFDKAESVRPKGHCVAVRVTSEDPDDGFKPTSGKVQELNFKSKPNVWAYFSVK
SGGGIHEFSDSQFGHVFAFGESRALAIANMVLGLKEIHIRGEIRTNVDYTIDLLHASEYR
GNKIHTGWLDSRIAMRVRAERPPWYLSVVGGALYKASTSSATMVSDYVGYLEKGQIPPKH
ISLVHSQVSLNIEGSKYTVDLVKGGPRSYKLKMNQSEVEAEIHTLRDGGLLMQLDGNSHV
IYAEEEAAGSRLLIDGRTCLLQNDHDPSRLVAETPCKLLRFLVSDGSHLDADTPYAEVEV
MKMCMPLLLPASGVIHFKITEGQAMQAGDLIASLDLDDPSAVRKAEPFHGSFPLLGPPSA
ISGKVHQRCAASLNAAKMILSGYEHNIDEVVQDLLNCLDSPELPFLQWQECMAVLATRLP
KPLRDELDVTYKNYERISTSLKNSDFPARALRGVLEAHLLSYPEKDKATQERLVDPLMSL
VKSYEGGRESHARVIVQSLFEEYLSIEELFNDNIQADVIERLRLHYTKDLLKVVDIVLSH
QGVRNKNKLILRLMEALVYPNPAAYRDKLIRFSALNHRSYSELALKASQLLEQTKLSELR
SSIARSLSELEMFTEEGEHLDTPRRKSAINERMEDLVSAPLAVEDALVGLFDHSDHTLQR
RVVETYVRRLYQPYLVMGSVRMQWHRSGLIASWEFSDEHIKRRDRSEDQTLDNPMSEKHK
ERKWGAMVIVKSLQFLPMAISAALKETGHSSHDTKSNGSLESVGHGNMLHIALVGINNPM
SMLQDSGDEDQAQERINKLAKILKEKQVSSALRSAGVGVISCIIQRDEGRAPVRHSFHWS
LEKLYYEEEPLQRHLEPPLSIFLELDKLKGYENVQYTPSRDRQWHLYTVVDKPQPIQRMF
LRTLVRQSNTDESFQIYHGQDIGKPRAQKALSYTSRSILRSLNAALEELELHGHNTKVKA
DYAHMYLCILREQQIEDFVPYYRSVEVVAGQEEATVGMILEELAHEVHESVGVRMHRLGV
SEWEVKLWMPSVGQASGVWRVVVTNVTGHTCTVHVYRETEDTGNQEVVYHSSFSKLGPLH
GVPVTQRYQPLGLLDRKRLLARKSNTTYCYDFPLAFKMALQRSWELQCPGTKKPKDSLLK
VTELAFADKQGAWGTPLVPVERPSALNDVGMVAWSMEMCTPEFPNGRTILVVANDVTFKA
GSFGPKEDAFFLAVSNLACEKKLPLIYMAANSGARIGVAEEVKACFRVGWSDESSPDRGF
QYVYLTPEDYDLIGSSVIAHELQLENGETRWVIDTIVGKEDGLGVENLTGSGAIAGAYSR
AYKETFTLTYVTGRTVGIGAYLARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQL
GGPKIMSTNGVVHLTVSDDLEGVSAILKWLSYVSSHVGGPLPILSPSDPPERHVEYIPEN
SCDPRKAICGVQDNNSGRWFGGIFDKESFVETLEGWARTVVTGRAKLGGIPVGIVAVETQ
TVMQTIPADPGQLDSHERVVPQAGQVWFPDSASKTAQALMDFNREELPLFIMANWRGFSG
GQRDLFEGILQAGSTIVENLRTYTQPVFVYIPMMGELRGGAWVVVDSKINPDHIEMYAER
TAKGNVLEPEGMIEIKFRTKELLECMGRLDQHLINLKESLQAARGSGDPGVVEALKVQIR
SREKQLLPVYTQIATRFAELHDTSLRMASKGVIKEVVDWENSRSFFYKRLNRRVAEGSLV
KVVRNAAGDQLSHKLAMDLIKKWFLDSKPTEVGESAWLDDADFFNWKDDPRNYEEQLQEL
RVEKILLQLSSIGESTSDLQALPQGLAGLLSKVEPSSRVQLVEELRKVLS
Download sequence
Identical sequences A0A2G5EH38
Aquca_008_00079.1|PACid:22061626 Aquca_008_00079.2|PACid:22061625 Aquca_008_00079.3|PACid:22061627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]