SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_008_00175.4|PACid:22061571 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_008_00175.4|PACid:22061571
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.76e-43
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 561-635
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000576
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_008_00175.4|PACid:22061571
Sequence length 683
Sequence
MAFAHSSSGGVPDSGSLNDTLYKELWHACAGPLVTVPREGERVYYFPQGHMEQLEASTHQ
ALDQKMPSFNLPSKILCKVVHVQLRAEPETDEVYAQITLLPEPDQSEVTSPDPPLPEPER
CMAHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQNPPWQELVATDLHGNEWHFRH
IFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGESGELRVGVRRLLRQLSNMPSSVIS
SHSMHLGVLATASHAISTGTLFSVFYKPSQSEFIVSLNKYLEARNHKLSVGMRFKMRFEG
EEAPERRFSGTIIRVGENASPWWADSEWRSLKVQWDEPSSIPRPDRVSPWELEPLVCTPS
ASQPAQRTKRSRPPVLASTTPDQSIHSTLGMWRTPVEPPLNFSYSGLQRGRELYQSPNPG
SPFPTARKPITLGFSGTSPASAVSSNPLYWSNRVESPTESFKPIINRESGETRKETGNGY
RLFGIQLIENSNVEETLPVVPVSVSALVEDESIPSLDAGSDRHSQPSNINESDIPAVSSD
PEKSCLRSPQEMQSRQIRSCTKVHMQGVAVGRAVDLTLFERYEDLLRKLEGMFDIEGELC
GPTKKWQVVYTDDEDEIMMVGDDPWHEFCSMVRKIFIYTVEEVKRLSPRVKLPTINNDIK
SGNLDSDIGVGTEDQSSVVGSDS
Download sequence
Identical sequences A0A2G5EHJ9
Aquca_008_00175.4|PACid:22061571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]