SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_008_00175.5|PACid:22061572 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_008_00175.5|PACid:22061572
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.76e-43
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 560-634
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000576
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_008_00175.5|PACid:22061572
Sequence length 682
Sequence
MAFAHSSSGGVPDSGSLNDTLYKELWHACAGPLVTVPREGERVYYFPQGHMEQLEASTHQ
ALDQKMPSFNLPSKILCKVVHVQLRAEPETDEVYAQITLLPEPDQSEVTSPDPPLPEPER
CMAHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQNPPWQELVATDLHGNEWHFRH
IFRGQPRRHLLTTGWSVFVSSKRLVAGDAFIFLRGESGELRVGVRRLLRQLSNMPSSVIS
SHSMHLGVLATASHAISTGTLFSVFYKPRTSQSEFIVSLNKYLEARNHKLSVGMRFKMRF
EGEEAPERRFSGTIIRVGENASPWWADSEWRSLKVQWDEPSSIPRPDRVSPWELEPLVCT
PSASQPAQRTKRSRPPVLASTTPDQSIHSMWRTPVEPPLNFSYSGLQRGRELYQSPNPGS
PFPTARKPITLGFSGTSPASAVSSNPLYWSNRVESPTESFKPIINRESGETRKETGNGYR
LFGIQLIENSNVEETLPVVPVSVSALVEDESIPSLDAGSDRHSQPSNINESDIPAVSSDP
EKSCLRSPQEMQSRQIRSCTKVHMQGVAVGRAVDLTLFERYEDLLRKLEGMFDIEGELCG
PTKKWQVVYTDDEDEIMMVGDDPWHEFCSMVRKIFIYTVEEVKRLSPRVKLPTINNDIKS
GNLDSDIGVGTEDQSSVVGSDS
Download sequence
Identical sequences A0A2G5EHR3
Aquca_008_00175.5|PACid:22061572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]