SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00168.2|PACid:22034184 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00168.2|PACid:22034184
Domain Number 1 Region: 218-423
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.47e-19
Family WD40-repeat 0.0075
Further Details:      
 
Weak hits

Sequence:  Aquca_009_00168.2|PACid:22034184
Domain Number - Region: 18-73
Classification Level Classification E-value
Superfamily Tropomyosin 0.00915
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00168.2|PACid:22034184
Sequence length 434
Sequence
MDRILKKPKLEEESNGIKEEYEEQEEALVALIEHRTKEVDHVKQKISYYKSQLEQAERRL
NDSQSKLARLRSRDSLTGSRKAIVDCNRNVKEEPKSSSPVCIEESNSGSQSNSRPQIIIP
AVKPKIAEPVKLAESSTKASVGSGSRVGALVSTQSNGVRKVKEEVSCKPSDELEVVEVQA
KRTKRKFEQKEHKELIPLIRSYSSPSMVHCQPGVHISSQHKRKLRSLVLCPSDDQLFVTS
ALDGIVNLWQVHSKGSGASLLSSTDCVSTKQRRWPEDITWHPHGGSLFCVYTADAGDSQL
SILDLNSSQRGKRVTYSEEKPHVKGIINNIVFMPWADLCFVTGGSDHAVVIWKEKDGENS
WKHKSLHRNLHSSAVMGVAGLQQKNIVLSAGADKRIIGFDVMAGRADFKHQIECKCMSVL
PNPSDFNLFMVQTG
Download sequence
Identical sequences A0A2G5ECF9
Aquca_009_00168.2|PACid:22034184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]