SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00209.4|PACid:22034790 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00209.4|PACid:22034790
Domain Number 1 Region: 58-233
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.27e-49
Family WD40-repeat 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00209.4|PACid:22034790
Sequence length 241
Sequence
MNAEGEGMNNSSDDERDEGEIYLEENDIIDEINVDEEDLPDVGDDNEAEYDVDEPDDSIH
LFTGHQGELYTVASSPTDAVLVATGGGDDKGFLWKIGQGDWAQELPARRDSVNSLAFSSD
GQLLASGGLDGLIQVWDVSSGSLKCTLDGPGGGIEWVKWHPRGHVLLAGSEDSTIWMWNA
DKGTYLNMFSGHGGNVTCGDFTPDGKTICSGSDDASLRIWNPKNGENLHVVRGGNFSTGS
H
Download sequence
Identical sequences A0A2G5ECH6
Aquca_009_00209.4|PACid:22034790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]