SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00269.1|PACid:22034510 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00269.1|PACid:22034510
Domain Number 1 Region: 428-486
Classification Level Classification E-value
Superfamily FF domain 1.44e-17
Family FF domain 0.00042
Further Details:      
 
Domain Number 2 Region: 493-560
Classification Level Classification E-value
Superfamily FF domain 2.49e-16
Family FF domain 0.001
Further Details:      
 
Domain Number 3 Region: 778-836
Classification Level Classification E-value
Superfamily FF domain 0.0000000000222
Family FF domain 0.0035
Further Details:      
 
Domain Number 4 Region: 199-233
Classification Level Classification E-value
Superfamily WW domain 0.000000000105
Family WW domain 0.0012
Further Details:      
 
Domain Number 5 Region: 227-269
Classification Level Classification E-value
Superfamily WW domain 0.000000000178
Family WW domain 0.0016
Further Details:      
 
Domain Number 6 Region: 565-628
Classification Level Classification E-value
Superfamily FF domain 0.00000000275
Family FF domain 0.0046
Further Details:      
 
Domain Number 7 Region: 633-708
Classification Level Classification E-value
Superfamily FF domain 0.00000000994
Family FF domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00269.1|PACid:22034510
Sequence length 983
Sequence
MASNSQPPGGQTLWPPIGGPAGPPQNFGPPIPIQFQPGFPQQQAHPYNLASSQNFRPVGQ
GISVSNVGLPASQSQQLQFPQMLQQLPLRPGQPSFGPPSSQGVPSPYAHQNRPLTPQQNT
PPLNNHGPSVGGMGVAPSSSYTYQPIPHMHAPIVGGQTSVSSGSHTTLVPPQQSIQQPLV
TASMATKVQGSATIQSSTIWIEHTSADGRRYYYNRITRLSSWEKPQDLMTPIERADASTD
WKEFTSPDGRKYYYNKATQKSTWTMPSELKLAREQLQRGDGQIMQPDAPATCQVPDSVTV
SSVEAPSITSSAISDVSSPVPVVPVPAVFTPLQAVGSISTVDVKIQSPVSVVTPLSVNVS
EKAEATTALMTTAATMSVIDDVSPQKVANSVDETSLQDLEEAKNTMAAAGKTNVTVLEEK
TVEAELISYANKQDAKDAFKALLESANVESDWSWEQAMRVIINDKRYGALKSLSERKQVF
NEYLGQRKKQEAEDRRTKQKQAREDFIKMLEDSDVLTSTTKWSKAITIFEDDERFKAVER
VRDREDIFESYITELQKKERAKAHEENKRNIREYKQFLQSCDFIKANSQWRKVQERLEQD
ERCSRLEKIDRLKIFQEYLNDLEKEEEEQKKIEKEQLRRAERNNRDEFRKLMEGHVAAGV
LTAKTHWREYHEKVKDLPAYVAASSNTSGATPKVLFEDVAEELEKQYYDDKIRIKDAIKF
KKITMASTWTIDDLKVAVSEELSSSPISDINFKLAFDELLERVKEKEEKEVKKRNNLADN
FSQFLYSIKEINSTSTWDECKALIEDSQEYRSIGEESFKREIFEEYITHLLEKAKEKERK
RSEEKAKKEKERGERERRKEKERKEKDREHGRDRGEERSKKIETESGDVDVKEARKREKE
RDRKHRKRRQNEGDEVSSDKEENEESKKSRRHRSDGKKSRKHVNSNESDSEGRHKRHRRE
HRHGSRRNGDLEDGELGEDGEIR
Download sequence
Identical sequences A0A2G5ECT3
Aquca_009_00269.1|PACid:22034510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]