SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00392.1|PACid:22033700 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00392.1|PACid:22033700
Domain Number 1 Region: 181-375
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-33
Family BCR-homology GTPase activation domain (BH-domain) 0.0013
Further Details:      
 
Domain Number 2 Region: 13-125
Classification Level Classification E-value
Superfamily PH domain-like 4.38e-17
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00392.1|PACid:22033700
Sequence length 879
Sequence
MSASLASFERPRIGVMNTVFKSGPLFISSRGIGWKSWKKRWFILTRTSLVFFKNDPSALP
QKGGEVNLTLGGIDLNNSGSVVVREDKKLLTVLFPDGREGRGFTLKAETSEDLFEWKTAL
EHALAQAPSAALVMGQNGIFRSDTADTIEGSLHQWRDKRSTKSLVVGRPVLLALEDIDGG
PSFLEKALRFLEKFGTKAEGILRLSADVEEVYLRVQEYERGKNEFGSHEDAHVIGDCVKH
VLREMPSSPVPASCCTALLEAYRIEQKEDRVNALRSAILETFPEPNRRLLQRILKMMHII
VAHASENRMTASAVAACMAPLLLRPLLAGECELDEDFDINSDNSAQLLAAANAANNAQAI
VTTMLEEYESIFNVDNLHRRSLSADSRIEISGSEDSTDDETLAAKDNGFHDAENEIAAEL
NDDPERIFRGKLSESSGYAGSDLYDNKAQVYGGDDSDAESSGENYTMERNQKSCKDPHKL
SRNCSAQFNEQSLVKKGSENLVAEMNTPRTSPGISSQRSMAEILSLVDPGHSLPGPGSEL
YSETPSSKISVSNSSVKRSTFWGRNTVRKNTSVESIDSSGEEELAIQRLEIAKIDLHNRI
AKEEKGNAILQASLERRKQALHERRMALEQDVSRLQEQLQAERDLRAALEVGLSMSTEQF
SSASGMNSKTRAELEEIALAEADVVRLKQKVAELHLQLNQQRHTQYGSLSDACDRYQRIQ
NLHAQQKFHQQDFDTKLAFVNRERKQRNEESSLGAECGAVKSLALASVLKGAQLPGKPVA
EATSLGDSVSTETSTNISADELCAVDSASVPPTSKSTEAMAYQRHPSATSSALVELTTRL
DFFKERRNQLMEQLHSLDLNSGLASSHGFAYKPSSPPWN
Download sequence
Identical sequences A0A2G5EDD8
Aquca_009_00392.1|PACid:22033700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]