SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00466.2|PACid:22034970 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_009_00466.2|PACid:22034970
Domain Number - Region: 934-1018,1105-1183
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00687
Family WD40-repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00466.2|PACid:22034970
Sequence length 1404
Sequence
MAVPDEDSSSSQSRSSSDTKGKGAYYLAKCVLKGSAVLQAVHGHLRSSTSNDIVFGKETS
IELVIVGEDGVMQSVCEQTVFGVIKDLAVLRWNEKFRAPDPQTLGKDLLVVLSDSGKLSF
LTFCNEMHRFFAVSHLQLSDPGNSRHQLGRMLAIDSNGCFGAVSAYEDQLALFSVSISAG
SNIVDKEMFYPSENEGDASSRTSRGIERTNICGTIWSMCFISKDDSQLSKDACNPVLAII
LHRKGSVLNELLLLGWDTSDHTIHVLSQFTEPGPLALDIVDVPYGSGHALLFRVGDALLM
DLRDPRSPSCVYRTSLSLLPSIVEEQNSVEQSSRGLDVDDEGSFNAAARALLELRDSRME
MSRDDDPMNIDSECGKISTARLVCSWSWEPGNTSTPRLIFSLDTGEIFTMEISSHPDGVK
VNLSDCFYRSLPCKTILWVREGFVAALVEMGDGMVLQFESGRLIYRSPIENIAPILDMSV
VDYHDEKQDQMFACCGMAPEGSLRIIRSGISVEKLLRTAPIYQGITGTWTTKMKVVDSYH
SFLVLSFVEETRVLSVGLSFSDVTEAVGFQTDTCTLACGLVCDGLLVQIHKNAVRLCLPT
TAAHPEGIPLTAPICTSWFPDNVSISLGAVGHNVIIVATSNPCFLYILGARSLSAYHYEL
YEMQHVRLQNEVSCISIPQRSSDFRSSMSFINVSGGGPGASLPAGVDIDNIFVIGTHKPS
VEVLSFSPEKGLRHLSCGTISLTNTLGTTITGCIPQDVRLVLVDRLYVLSGLRNGMLLRF
EWPATCAVFPSKVSSRSSFISSCFTNVDASYRKQKDPVLTGKQYCTPEWSEKAEEKVPVH
LQLIAIRRIGITPVFLVPLCDSIDADIIALSDRSWLLQAARHSLSYTSISFQSATHVTPV
CSVDCPKGILFVAENSLHLVEMVHTKRLNVQKFAIGGTPRKILYHNESRLLLVMRTDLET
GLSSSDICFVDPVSGSLLSTYKLEAGEIGKSMQLVKVGSEQVLVVGTSQSTGRIIMSSGE
AESDTKGRLLVLCLKHMQNTDSNSLTLCSKPGSSSHTSPFREIVGYATEQLSSSSLCSSP
DDTSCDGVKLEETEAWRFRLAYQAILPGVVLAVCPFLDRYFLASAGNTLYVYGFLNENPQ
RVRRFAFGKTRFTITCLTTLYTRIAVGDCRDGILFYSYQEDPDLRKLGKLEQLYCDPVQR
LVADCTLMDMDTAVVSDRRGSVTVLSRTIDLEENASPECNLTLSCSYYIGETVMSIRKGL
LSYKLPVDDALKGCDSTDTRFDSAQNSIVASTLLGSVIIFIPISREEHEILEVVQARLVA
HPLTEPVLNNDHNEFRGRGSPLIHQNSAHLLKLVYSLEGTRSSFVLGSNIELLKGLRKLW
TVYCHSSHWHNLLFLVLVMLCMQY
Download sequence
Identical sequences A0A2G5EDS4
Aquca_009_00466.2|PACid:22034970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]