SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00466.5|PACid:22034973 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Aquca_009_00466.5|PACid:22034973
Domain Number - Region: 929-981,1103-1179
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0152
Family WD40-repeat 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00466.5|PACid:22034973
Sequence length 1342
Sequence
MAVPDEDSSSSQSRSSSDTKGKGAYYLAKCVLKGSAVLQAVHGHLRSSTSNDIVFGKETS
IELVIVGEDGVMQSVCEQTVFGVIKDLAVLRWNEKFRAPDPQTLGKDLLVVLSDSGKLSF
LTFCNEMHRFFAVSHLQLSDPGNSRHQLGRMLAIDSNGCFGAVSAYEDQLALFSVSISAG
SNIVDKEMFYPSENEGDASSRTSRGIERTNICGTIWSMCFISKDDSQLSKDACNPVLAII
LHRKGSVLNELLLLGWDTSDHTIHVLSQFTEPGPLALDIVDVPYGSGHALLFRVGDALLM
DLRDPRSPSCVYRTSLSLLPSIVEEQNSVEQSSRGLDVDDEGSFNAAARALLELRDSRME
MSRDDDPMNIDSECGKISTARLVCSWSWEPGNTSTPRLIFSLDTGEIFTMEISSHPDGVK
VNLSDCFYRSLPCKTILWVREGFVAALVEMGDGMVLQFESGRLIYRSPIENIAPILDMSV
VDYHDEKQDQMFACCGMAPEGSLRIIRSGISVEKLLRTAPIYQGITGTWTTKMKVVDSYH
SFLVLSFVEETRVLSVGLSFSDVTEAVGFQTDTCTLACGLVCDGLLVQIHKNAVRLCLPT
TAAHPEGIPLTAPICTSWFPDNVSISLGAVGHNVIIVATSNPCFLYILGARSLSAYHYEL
YEMQHVRLQNEVSCISIPQRSSDFRSSMSFINVSGGGPGASLPAGVDIDNIFVIGTHKPS
VEVLSFSPEKGLRHLSCGTISLTNTLGTTITGCIPQDVRLVLVDRLYVLSGLRNGMLLRF
EWPATCAVFPSKVSSRSSFISSCFTNVDASYRKQKDPVLTGKQYCTPEWSEKAEEKVPVH
LQLIAIRRIGITPVFLVPLCDSIDADIIALSDRSWLLQAARHSLSYTSISFQSATHVTPV
CSVDCPKGILFVAENSLHLVEMVHTKRLNVQKFAIGGTPRKILYHNESRLLLVMRTDLET
GLSSSDICFVDPVSGSLLSTYKLEAGEIGKSMQLVKVGSEQVLVVGTSQSTGRIIMSSGE
AESDTKGRLLVLCLKHMQNTDSNSLTLCSKPGSSSHTSPFREIVGYATEQLSSSSLCSSP
DDTSCDGVKLEETEAWRFRLAYQAILPGVVLAVCPFLDRYFLASAGNTLYVYGFLNENPQ
RVRRFAFGKTRFTITCLTTLYTRIAVGDCRDGILFYSYQEDPDLRKLGKLEQLYCDPVQR
LVADCTLMDMDTAVVSDRRGSVTVLSRTIDLEENASPECNLTLSCSYYIGETVMSIRKGL
LSYKLPVDDALKGCDSTDTRFDSAQNSIVASTLLGSVIIFIPISREEHEILEVVQARLVA
HPLTEPVLNNDHNEFRGRGSPV
Download sequence
Identical sequences A0A2G5EDT5
Aquca_009_00466.4|PACid:22034972 Aquca_009_00466.5|PACid:22034973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]