SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00479.1|PACid:22034566 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00479.1|PACid:22034566
Domain Number 1 Region: 561-786
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.09e-45
Family Protein kinases, catalytic subunit 0.00066
Further Details:      
 
Domain Number 2 Region: 119-242
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.7e-22
Family alpha-D-mannose-specific plant lectins 0.0025
Further Details:      
 
Domain Number 3 Region: 216-302
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000498
Family alpha-D-mannose-specific plant lectins 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00479.1|PACid:22034566
Sequence length 819
Sequence
MFFSVSTVQMPKLWRNQLETRIPIEEEYYGGKFFQNYIFRRFGPILVLLILVWGSSVICE
EFSMVSLPLGFEISGFERKKSFVSENGVFAFGFFNDNLKDDGSFAVGIWYNLENKTANVP
VWTAGGGVRVSGNSTIRLSMDGCLTLIDNGVVVWSTDTKGLGVQSTSLLNNGNLVLFGSG
EKIIWESFNSPTNILLPGQSLQYPYSLRPPLTDSISSYYSLVIRHSGELALVWANNVTYW
NSRLGSTTVAREARFEANGVLGLIDGTGATVWSKSSEDFRDPSVVLRHLRIDSDGNLRIY
SWDSVLRAWRVGWQAVENQCKVFGSCGLFSFCAYNTGVPTCSCLFQDSLNLEGGSQRTDS
RCNKMADIGKCKSSMSTLKHTVLYGLYPPHDVGVMLNQEACKAYCLNDTTCVAATSANDG
SGLCMIKRTSFISGYQDASGSAVSFLKVCLVPLAVSASQADPRSNAASNSLPSGKNISRT
KSWKSVIVTVAVIVVVSACAFLGIEILVFWFIHRRRQIKAQSRIPFGKDAQMNPHYSALI
RLSYDEVKELTANFKDQLGPSVFKGVLPNRIPVVAKVLNSVVASERDFRMIVTTLGATHH
RNLVQLKGFCFEPKHKILLYEYIPKGSLQKWLSKPKQERNGINWQQRLNIARGIARALAY
LHSECQQCIAHGNLKFENVLLDEKLVAKLTGFGLHSLLGNDSASLSESFPERDIYMFGQM
LLHILTGQQDIVGYSPQRLIHEMYHDKKSVGSVEWEGIERACRIALWCMHDRPFLRPSIG
EVVKVLEGNLSVDRPPPSAAFMRENQVDYEESNEISVAS
Download sequence
Identical sequences A0A2G5EDS8
Aquca_009_00479.1|PACid:22034566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]