SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00504.1|PACid:22034611 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00504.1|PACid:22034611
Domain Number 1 Region: 87-145
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000000000842
Family eIF5a N-terminal domain-like 0.0055
Further Details:      
 
Domain Number 2 Region: 147-208
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000351
Family Cold shock DNA-binding domain-like 0.0032
Further Details:      
 
Domain Number 3 Region: 211-267
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000168
Family Cold shock DNA-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00504.1|PACid:22034611
Sequence length 269
Sequence
ETGSEDARERERERERVEMHALQRRLSKSLVNKISWISQQRTFTTHTSSSTSSLHPLTNS
SNNFPPRGTLVAPWFAIQHRGAKVLGSDVRFGNVVQRKGRIYQVLKSQHTQQGRGGATIQ
VELRDVVTGNKVTERFRTDEAMEKVFVEEKPFTFLFSEGDSVTVMEPNTFEQMEISKELF
GKAAAYLKDDMKVTLQMYDGKIMSASIPTRVTCTVSEAKSHVKGLTATPQYKRVLLDNGV
TVLVPPFIEAGDEIIINTIDDSYITRAKE
Download sequence
Identical sequences A0A2G5EDY2
Aquca_009_00504.1|PACid:22034611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]