SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00504.2|PACid:22034612 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00504.2|PACid:22034612
Domain Number 1 Region: 69-127
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000000000722
Family eIF5a N-terminal domain-like 0.0055
Further Details:      
 
Domain Number 2 Region: 129-190
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000313
Family Cold shock DNA-binding domain-like 0.0032
Further Details:      
 
Domain Number 3 Region: 193-249
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000149
Family Cold shock DNA-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00504.2|PACid:22034612
Sequence length 251
Sequence
MHALQRRLSKSLVNKISWISQQRTFTTHTSSSTSSLHPLTNSSNNFPPRGTLVAPWFAIQ
HRGAKVLGSDVRFGNVVQRKGRIYQVLKSQHTQQGRGGATIQVELRDVVTGNKVTERFRT
DEAMEKVFVEEKPFTFLFSEGDSVTVMEPNTFEQMEISKELFGKAAAYLKDDMKVTLQMY
DGKIMSASIPTRVTCTVSEAKSHVKGLTATPQYKRVLLDNGVTVLVPPFIEAGDEIIINT
IDDSYITRAKE
Download sequence
Identical sequences A0A2G5EDZ1
Aquca_009_00504.2|PACid:22034612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]