SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00595.2|PACid:22034846 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00595.2|PACid:22034846
Domain Number 1 Region: 729-1234
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 3.93e-121
Family Molybdenum cofactor-binding domain 0.0000000816
Further Details:      
 
Domain Number 2 Region: 211-421
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.91e-38
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0009
Further Details:      
 
Domain Number 3 Region: 593-727
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 1.7e-34
Family CO dehydrogenase molybdoprotein N-domain-like 0.00022
Further Details:      
 
Domain Number 4 Region: 106-217
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.26e-28
Family CO dehydrogenase ISP C-domain like 0.00032
Further Details:      
 
Domain Number 5 Region: 12-98
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.48e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00044
Further Details:      
 
Domain Number 6 Region: 437-546
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 0.0000000000000235
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00595.2|PACid:22034846
Sequence length 1249
Sequence
MENNKEKNNNSKLVFAINGERFELSKIHPSTSLLEFIRTQTRYKGTKLSCGEGGCGACVV
LLSKYDPVLKQVEDFSVSSCLTLLCSINGCSVTTTEGIGNSKDGFHSIHERFAGFHASQC
GFCTPGMCMSFFSALINAEKTQRNDPPSGFSKLTMSEAEKSIAGNLCRCTGYRPIADACK
SFAGDVDMEDLGLNSFWGRGDSTDVKISKLPSYTQNKVCTFPEFLKSEIQSKTLFDTEGC
CWYAPDSVEDLETILDSVNVDNGGHIKLVVGNTGTGYYKELEPHNKYIDLRNIPELSVIN
RDSTGIEIGAAVTISKAIQALKGEGESISESTGNLVLTKIAEHMNKVASKFIRNTASLGG
NLVMAQRNQFPSDIATILLAAGTMVDIQRGGKRLKLTLDEFLEGPTSDFKTVILSVKIPY
WDPRSNFSSENKPQIKFETYRAAPRPLGSALAFLNAAFLAQFSTGQASDVVVLQKIRLVF
GAYGTKHAIRAKKAEEFLTGKPVGVNILSEAIHLIRDTIVPEEGTSSPAYRSSLAVSFLF
EFFHPMLEADMLNPNDTLHGYMNTLETSEPNNKFKPIHQSKCSSLLLSAKQMVEFSGQYH
PVGQPTKKSGAELQASGEAVFVDDIPSPKDCLHGAFINSTKPMAWVKGIEFRSFPPLDGV
LKVISFKDIPEKGENIGCKTIFGSEPLFADDITTFAGQPLGLVVADTQKHADMAANLAVV
DYDTENLKPPILSVEEAVERSSFFEVPPILNPKPVGDFSKGMAEADHKILSAEIKLGSQY
YFYMETQTALAIPDEDNCMVIYSSIQCPENAGIVVARCLGVPNHNVRVITRRVGGGFGGK
AIRAMPVAAACALAAHKLCRPVRIYVNRKTDMIMAGGRHPMKINYSVGFKSDGKITALHL
DILINAGISEDISPMLPHNILGIVRQYNWGALSFDMKVCKTNLSSKSAMRAPGEVQASYI
AEAVIEHVASYLSIETTLVRNKNIHTYDSLKFFYSGNTGDPLEYTLPSILDKLVKSSCFH
ERFVAIKCFNSSNKWSKKGISCVPIVHEVMLRPTPGKVSILGDGSVVVEVGGIELGQGLW
TKVKQMTAFGLSSIGCVGGGDLLKRIRVIQADTLSIVQGGFTAGSTTSEANCEAVRLCCN
TLVERLTSLKESLLEKMGSVSWETLIIQATQQAVNLSASTYYVPEVTSMQYLNYGAAVSE
VEIDLLTGSTTILRTDIIYDCGQSLNPAVDLGQLLESHHYFWQSQFTVQ
Download sequence
Identical sequences A0A2G5EEE6
Aquca_009_00595.2|PACid:22034846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]