SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00752.1|PACid:22033576 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00752.1|PACid:22033576
Domain Number 1 Region: 329-417,453-717
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.35e-46
Family WD40-repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 31-174,249-408
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.25e-30
Family WD40-repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00752.1|PACid:22033576
Sequence length 845
Sequence
LVLEEIIGLTTKNANGLSSNMLTGDCVYLAGCVVVIYNVESGNQSHLVVSSRMPKPLTCV
AVSNQNGGIIAAGESGHKPAVLVWDYSTRTLLAELKVHRYGVACIAFSPDGKHLISVGFP
HDGYLCLWDWRNGGLVTKVKSSSSCSVISSVIFSSDANFFVTAGKKHMKFWTVGPSLRLL
SNVGAGLPAMDGKSANLGCQKGSSFISVTSASWTVPIPGRDQAAEFYPIYALTDAGVLCL
LGSGFSMKKWVDLKVEKGFALSVSNKLIACACNNGVVQLFSTETLMFAGSLQYSELKETH
NSRDMTCEDKHIRSDPTIPDAIACQFVTSEKLVVIYGNHNLYVWDVRDVAKVSRCSVLVS
HGACIWDVKNLSCENMHDPNLACVARGCCGGVSFATCSTDGSIRLWDLALRLELKQKNYR
PSVAISEQVDGNSNDTEKFAAIHLVSAGIFERDIVESGVSTQGFRAMAVSSDGKYLAAGD
CQGNLHVYNLNTADYTCIQDAHEAEILSLSFTLSSKNSSCPGRYLLASGGRDRMIHLYDV
ERNLELIESLDDHSAAVTSVELTYNGCKILSCSADRSLVFRDVAITDSGCNISRCHQQIA
SNGTVYDMAIDPATEVAVTVGQDKKINTFSTSTGKLIKTFKQDRDFGEPIKVSIDPSSSY
LVCSFSNKSMCIYDFNNGDLVTQVVGHGEVITGVIFLPDCKHIISVGGDGCIFVWKLPSL
MSSRMLHRIMERAGPLSPTSTTKKGFSSGSMLYEKADHPFDNDSKDFSVVENFDQDYKKA
LFKEASDFRFSISRLPNWAKTKVTPNEILSTHSESTSSQVHFIGVETKSKWYVLLQHCPF
EARLC
Download sequence
Identical sequences A0A2G5EF82
Aquca_009_00752.1|PACid:22033576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]