SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00800.1|PACid:22034841 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00800.1|PACid:22034841
Domain Number 1 Region: 101-218
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 7.06e-16
Family N-utilization substance G protein NusG, N-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 283-333
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000012
Family N-utilization substance G protein NusG, C-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00800.1|PACid:22034841
Sequence length 337
Sequence
MKAELLLWSNRVTSSPFLSLPLFSSPSYLLYNKTHKVISATLESSGQLTARERRQLRNER
REEKTTNWKEEVEEKLLKKQKKKFANWKEELNLDNLAIDGPQWWAVRVSRLNGHETAEQL
ARYLARIFPNVEFKVYAPAVHVKRKLKNGTVSVKQKPLFPGCIFLRCVLNKELHDTIREC
PGIGGFIGSKVGNTKRQINRPRPVSIVDIEAMFRQAKEEQEKADQAFAEDQQSEEILKNE
NIRLNPIKNVMDSVPDSKPKRRTTKASTPVTSGSSIGSDDKLLTLGSSIRVVSGSFSDFK
GTLKKLDAKSGMATVVVTLFGKESIVDVDINQIVAEA
Download sequence
Identical sequences A0A2G5EFG3
Aquca_009_00800.1|PACid:22034841 Aquca_009_00800.2|PACid:22034840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]