SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00812.2|PACid:22033506 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00812.2|PACid:22033506
Domain Number 1 Region: 22-80
Classification Level Classification E-value
Superfamily Tim10-like 1.96e-19
Family Tim10/DDP 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00812.2|PACid:22033506
Sequence length 82
Sequence
MATGKLPTEAEKEQIFGMAQTEMEYRVELFNKLTAVCFNKCVEKRYKESELHLGENSCID
RCVSKYMQVNNMVGQLLQNPQM
Download sequence
Identical sequences A0A2G5EFJ4
Aquca_009_00812.1|PACid:22033505 Aquca_009_00812.2|PACid:22033506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]