SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00848.1|PACid:22034367 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00848.1|PACid:22034367
Domain Number 1 Region: 10-96
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-17
Family B3 DNA binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  Aquca_009_00848.1|PACid:22034367
Domain Number - Region: 432-530
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000471
Family Apolipoprotein A-I 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00848.1|PACid:22034367
Sequence length 551
Sequence
MEMRKRYFRVVIQGLEKKLLIPQNFARQIADNLSEVALLVDPSGSTWHVKFNRTTDGTYL
EDGWEIFSIDHSLSRGECLLFEYFGNLKFTVMIYAPSTMLREDCFVGNSSQELAQCGGRK
RHTEFSKARGTKGAIDKEVPFSSTSARSAAKKILQPLKLVKKDPFLDSVVGTGTKRRASE
HIVTPTFSDLDVEIIDITCHASPSALQRDQTYHRNIRAKTRRSKKTETPSSAFHTNQGKK
KASSSFPEDDEEIFDDLMFFSYDHDEQGIPSSMSPTAVQTEPETDYVPPPATSTPSIIPD
GTPPAPSRKSSIDRKRKQKVGKVFSGDQDTSKDPTQDNPPENHPMVSQFWRWGDKKEGPI
DILDTVADPETAVGVLHGSVLPGDKHKIEGLADLEEVKNLSSVHLASFNSLFVGLWDRVA
SERRRVEEFADLATAKESLEKQVAELTQELEEARKSVMENQQHKLRALKWELRFNDADHD
RKKVETIKNYLQSENQSLKGELDHARSNLAALRKEIRESMSQQAQELESPRMGNTQASDE
LAQNDDETSFT
Download sequence
Identical sequences A0A2G5EFM6
Aquca_009_00848.1|PACid:22034367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]