SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00860.1|PACid:22035305 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00860.1|PACid:22035305
Domain Number 1 Region: 53-170
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000222
Family Tropomyosin 0.01
Further Details:      
 
Weak hits

Sequence:  Aquca_009_00860.1|PACid:22035305
Domain Number - Region: 262-342
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0167
Family Myosin rod fragments 0.013
Further Details:      
 
Domain Number - Region: 302-437
Classification Level Classification E-value
Superfamily LemA-like 0.0248
Family LemA-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00860.1|PACid:22035305
Sequence length 448
Sequence
MASQHHASLGRKTLEGIRQKKAAERLKKASSGPDLQDSSIPSVGINRSQSGGQLSESDVN
GLVSQIKILERRNAELEEENKDVKSKLHAKEVKFDTLQKRLNELEQNSIPSLRKALRDVA
MEKDAAVTAREDLSAQLRIVKKRLKEAEDEQYRAEEDAAALRAELNSLQQQAMTNPLGGI
PSMGSISPDHLQGMEKELASLKFELQQESLLRQQEQQKLVEEQLQKSSLIAEKKELEERL
VALSEKASEPLNEAAGKEFSKQDKDKLEKQLHDMAVVVERLESSRQKLLMEVDTQSSEIE
RLFEENSSISTSYEEAVAVVVQWENQVKDCLKQNEELRGLLDKLRAEQASMPPVNTEEGK
SRLLEAEKNGGSVAGANMYTNENLLLKGQLAKAQSRAEELSAEVMKLSAQLQHAVQAYNG
LARLYKPVLRKIESSLIQMKQDGSVAVQ
Download sequence
Identical sequences A0A2G5EFQ5
Aquca_009_00860.1|PACid:22035305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]