SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00893.1|PACid:22033645 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00893.1|PACid:22033645
Domain Number 1 Region: 181-279
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.73e-21
Family B3 DNA binding domain 0.0043
Further Details:      
 
Domain Number 2 Region: 5-105
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-21
Family B3 DNA binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00893.1|PACid:22033645
Sequence length 288
Sequence
MRSDMKPEFFKIIHADLFTTEQLRIPPDFLKHISKDESGIAVIDEGPDATYSWHVQFCRT
EDGMFLTDGWKDFVRDHSLGKYDFLVFRYEGNMYFTVAIFDQTGCQKDVGFNKRMHQKLG
SSSGGKHRGRPLKTLIEVPRRRVGRPPKDLPLLSQVRGRSPSRRMPTEKEKADVWKAATA
FTSCFPYFIRPLYASSVYISYVVNIPADFARTYLPTRKTEFVLEDHLSGRFWTLNFNPGT
LNSFSGGWPTFVLDNQLEAGDICIFELTGKWRMRIHIFRACQTTKAHF
Download sequence
Identical sequences A0A2G5EFW9
Aquca_009_00893.1|PACid:22033645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]