SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00894.1|PACid:22034885 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00894.1|PACid:22034885
Domain Number 1 Region: 118-218
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-28
Family B3 DNA binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 2-101
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-22
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00894.1|PACid:22034885
Sequence length 221
Sequence
MKKPEFFKIIHPSLCTTEQLRIPPDFLKHISDEDNGIAVLEGPSATFDWHVRFCKKEGGT
YLTEGWKEFVRDNALGKYEFVVFRHRGNMCFHVEIYAKSGCKTLDEYKAKVRNAAMSFTS
TRPYFMRCLYPSCVYTSYVLNIPTDFAEAYLPKSKKEIVLQDRSGKSWFVTCNPGRRQYT
FCGGWTCFVNENQLNAGDVCVFELIGYMKLRVYIFRVNPTS
Download sequence
Identical sequences A0A2G5EFU8
Aquca_009_00894.1|PACid:22034885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]