SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00944.1|PACid:22033895 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00944.1|PACid:22033895
Domain Number 1 Region: 334-581
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-67
Family Extended AAA-ATPase domain 0.000000124
Further Details:      
 
Domain Number 2 Region: 591-780
Classification Level Classification E-value
Superfamily FtsH protease domain-like 2.35e-61
Family FtsH protease domain-like 0.0000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00944.1|PACid:22033895
Sequence length 823
Sequence
MIFSRIGRSLYQSERQRFIKNGILGGFVGRPSLINDTLGRSTTIVNGNLSGEGGGISVVR
SYLTSIGANKGLVSRGLLSDLNFSRGNPRIHRYFSSEAPKKKNYENFYPKDKKEIPKENN
QKAESKEDPNAEDHGNFQETLFKQIQNYITPLLFIAFVLSSLNFGPGDQKQISFQEFKNK
LLEPGLVDHIVVSNKSVAKVYVRSSPKIGDQRNSDIVQGPTDGGPARGNSGQYKYYFNIG
SVESFEEKLEEAQEALGIDTHDYIPVTYVSEVVWYSELMRFAPTVMIIAFLLYTGRKMQG
GFGGLGGTGKGGRGGIFNIGKAHFLKMDKNTKNKIYFKDVAGCDEAKQEIMEFVHFLKNP
KKYEDLGAKIPKGALLVGPPGTGKTLLAKATAGESGVPFLSISGSDFMEMFVGVGPSRVR
SLFAEARQCAPSIVFIDEIDAIGRARGRGGFTGGNDERESTLNQLLVEMDGFGTTAGVVV
LAGTNRPDILDKALLRPGRFDRQISIDKPDIKGRDQIFRIYLQKLKLDHEPSYFSQRLAA
LTPGFAGADIANVCNEAALIAARTESALITMDHFDSAIDRIIGGLEKKNKVISKLERRTV
AYHESGHAVAGWFLEYAEPLLKVTIVPRGTAALGFAQYVPSENLLMTKEQLFDMTCMTLG
GRASEQVMLGKISTGAQNDLEKVTKMTYAQVAVYGFSDKVGLLSFPQKDDGFEMTKPYSS
KTGDIIDTEVREWVAKAYDRTVQLLEEHKDHVGQIAELLLEKEVLHQEDLIRVLGERPWK
SSEQTNYDKYRDGFIEEDEKIIVNTEGENADGSSPLEPDVVPT
Download sequence
Identical sequences A0A2G5EG25
Aquca_009_00944.1|PACid:22033895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]