SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_00948.1|PACid:22034484 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_00948.1|PACid:22034484
Domain Number 1 Region: 53-287
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.31e-64
Family Extended AAA-ATPase domain 0.000000522
Further Details:      
 
Domain Number 2 Region: 297-486
Classification Level Classification E-value
Superfamily FtsH protease domain-like 2.22e-56
Family FtsH protease domain-like 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_00948.1|PACid:22034484
Sequence length 506
Sequence
MNFLEKVILCKEIMFLGHTALCVALIAYIWRQVTIKNTERKEQFFELEKNSRKKVCFDDV
AGCDEAKQEIIEIVEFLKNPKKYENFGAKIHKGVLLVGPPGTGKTLLAKAIAGESGVSFL
SISGSDFVQYVGAGPSRMRSLFSEAKNCAPSVIFIDEIDTIGRAPTCLNQLLVEMDGFGS
TNGVVVLAGTNMPDMLDKALLGPGRFDFQISIDTPDIRGRDQIFRIHLKAVKLDPKATNL
AQKLAVLTPGFTGADIAKVCNEAALIAARTDSEWVTMDHFESAMDRIFFGPEKPNKVISK
QDRRTVAYHESGHTVTAWFLEHIEPVRKVTIVPHGSALGYTERVPSENRIMTEKQFFDIA
CVTLGGRASEQIMLGEISTGSRDDLEKLTEMTYELVSRDGFSDKVGILSFPPGNKGSDGT
QPYSSTRKATIDAEVKKWVQKAYDHTLQIIKDHKEHVDQIAKQLLEKEVLYGEDLIKVLG
ERPWKSTEQTNYDRFKHSFIEEGAID
Download sequence
Identical sequences A0A2G5EG39
Aquca_009_00948.1|PACid:22034484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]