SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_01002.1|PACid:22035007 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_01002.1|PACid:22035007
Domain Number 1 Region: 237-527,566-685
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-114
Family Myotubularin-like phosphatases 0.000000129
Further Details:      
 
Domain Number 2 Region: 86-208
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-17
Family GRAM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_01002.1|PACid:22035007
Sequence length 879
Sequence
MAAPNSRFYRSTSAPRDDSKYKPQQQQQQHYYHHINNNNNNNNNSPSPSLPPYSSEKQME
GAGSWDAIEWTKVEPVSIHHGMSDLLLEAEEVIVPGYGVVLVNTDEAGTLLVTNFRLLFV
SEGTRKIIALGTIPLATIEKFSKLVMKPPSTSRPPDKSRPRRLLQIIGKDMRIIVFGFRP
KTKQRRNVFDALWRWTRPAGLRDLYTFTCGPSKYHNSNPKVRLLNEYVRLLGVSTTSRTS
EDEPFTLSNEWWRISGINSNYTMCPTYPSSLIVPKYISDEEVQQASTFRARCRLPVLSWC
HPGNGAVIARSSQPLVGLMMNSRSNADEKLVAALCTGATLAKGSRRKLYIADARPRKNAL
ANGAMGGGSESSSNYFQSEIVFFGIDNIHAMRDSLGRLRDYVDTYGSTSSDGMSSFLRNG
GWTWGGGNLSSMSASVSTLGDTVWLIHIQSVLAGSAWIAARVAIEASSVLVHCSDGWDRT
AQLVSLASLLLDPYYRTFAGFQALVEKDWLAFGHPFSDRMGTPAILGDEAVPSELSRQAS
TGNIPASPMRNSSGSSFTSQSNSSSHAQTSSPIFLQWVDCISQLLRIYPFAFEFSAGFLV
DFLDCILSCRFGNFLCNSEKERQQFGVPDACGCLWAYLTDLRVCGGSSHAHYNFFYDPLK
HGGPLLPPAASLAPTLWPQFHLRWACPSEAHFGEIEAQCWTMSKKLTEMQKAKDVAEKKA
KDVSTSMESLVMEMRKEKQLSSSAMDLAKNACRESSAIKRAIQSLGCKVQFSSSGDCTLD
IGGTPPEIQQKFVNFTKDGSMQWEEKSDVSVSISITAGDAVPNNPLSRACQTLCPLSSRE
GGCKWPDAGCVQLESQFVGLKANFDAFDQLSIYDRYFGS
Download sequence
Identical sequences A0A2G5EGC7
Aquca_009_01002.1|PACid:22035007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]