SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_01019.2|PACid:22033905 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_01019.2|PACid:22033905
Domain Number 1 Region: 396-627
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 5.34e-74
Family CAT-like 0.000016
Further Details:      
 
Domain Number 2 Region: 84-176
Classification Level Classification E-value
Superfamily Single hybrid motif 1.3e-25
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000848
Further Details:      
 
Domain Number 3 Region: 199-286
Classification Level Classification E-value
Superfamily Single hybrid motif 4.45e-24
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000983
Further Details:      
 
Domain Number 4 Region: 311-356
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000602
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_01019.2|PACid:22033905
Sequence length 627
Sequence
MASSRFRHLVVSRTPSIFKYRHFTTSRSLSRLVNVQNTFVERIGDATLSRPVSLAMVNGV
YDRSLTLKLQIGVRYFSSSDPTSHTVLEMPALSPTMNQGNITKWVKKEGDKIEVGDVLCE
IETDKATVEFESLEEGYLAKILAPEGSKDISVGQPIAITVEDLDDIKNLPATSGSDSKEE
QSTHQDAGTQTSSAELPPHIVLDMPALSPTMNQGNIAKWRKKEGDKIEVGDVICEIETDK
ATLEYESLEEGYLAKIIAPDGSKDILVGQPIAITVEDPDDIEKIPSTIGRVSEEKVDKSV
HQNVDNVDRAQSSSFSRISPSAKLLITEFGLDASSLKASGPRGTLLKGDVLAALKSGKGS
SKPSQTSKATKSASPKTAQDSTSVSSSKSSSFSHDADSHEDLPNTQIRKVIAKRLLESKQ
NTPHLYLSSDVILDPLLAFRKELKEQHNVKVSVNDIVIKAVAVALRNVPAANAYWDVSKG
EIVLCDSVDISIAVATEKGLMTPIVKNADQKTISAISSEVKELAEKARTGKLTPNEFQGG
TFSISNLGMFPVDQFCAIINPPQACILAVGRGNKIVEPVVDSDEKPAVVNKMNLTLSADH
RVYDGKVGSSFLSALRLNFSDIRRLLL
Download sequence
Identical sequences A0A2G5EGD4
Aquca_009_01019.2|PACid:22033905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]