SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_01062.2|PACid:22035248 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_01062.2|PACid:22035248
Domain Number 1 Region: 60-258
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.34e-17
Family WD40-repeat 0.0084
Further Details:      
 
Weak hits

Sequence:  Aquca_009_01062.2|PACid:22035248
Domain Number - Region: 856-893
Classification Level Classification E-value
Superfamily RING/U-box 0.000261
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_01062.2|PACid:22035248
Sequence length 926
Sequence
MAHSLPENGVDGDDEREEEDEDEDDDGGEEEEEEEDEEEEDEPRLKYQRMGGSIPSLLSN
DAAACIAVSERMIALGTHDGTVHILDLLGNQVKEFAAHTATVNDLSFDVEGEYIGSCSDD
GFVVINSLFTDEKIKFEYHRPMKAIALDPDYSRKSSLRFVAGGLAGQLFLNAKRWLGYRD
QVLHSGEGPIHAVTWRTNLIAWANDAGVKVYDTANDHRITFIERPRGSPRPELLLPHLVW
QDDTLLVIGWGTSVKVAAIRANNYRGANGAQTHVAISSTKQVDIVASFQTSYFISGIAPY
GDALVVLAYIPEKDDGQKEFSSTGPSRQGTAQRPEVRIVTWKNDELAMDALPVHGFEHYK
AKDYTLAHAPFSGSSYAGGQWAAGDEPLYYIVSPKDVVIAKPRDAEDHISWLLQHGWHEK
ALAAVEAGQGRTELLDEVGSRYLDHLILERKYAEAASLCPKLLRGSASAWERWVFHFAHL
RQLPVLVPFIPIDNPRLRDTAYEVALVALATNPSFHNDLLSTVKSWPSVIYSVLPVISAI
EPQLNTSTMTNTLKEALAELYIINGQYEKSFALYADLMKPELFEFIEKYNLHDAIQDKVV
QLMTLDCRRAVPLLIQNKDLITPSDVVTQLLNASNKCDSRRFLHLYLHSLFETNPHAGKE
FHDMQVELYADYDPKMLLPFLRSSQHYRLEKVFILGRMGNSKQALAVIINKLEDIEEAID
FVSMQHDDDLWEELIKQCLNKAEMVGVLLEHTVGNLDPLYIVNMVPNGLRIPRLRDRLVK
IITDYRTETSLRHGCNDILKADCVNLLVKYYKEARHAICIDSGEDEARPKRASRRSTAQA
FDKSVSMRAMGLKSRTRAGGRCCMCFDPFSIQKVSIITFFCCHAYHVTCLMDATTSVGSD
DDEEDEDDNQAGKSRMRCILCTTAAQ
Download sequence
Identical sequences A0A2G5EGJ1
Aquca_009_01062.2|PACid:22035248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]