SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_009_01099.1|PACid:22033977 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_009_01099.1|PACid:22033977
Domain Number 1 Region: 512-804
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.52e-78
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 86-199
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.63e-22
Family alpha-D-mannose-specific plant lectins 0.0057
Further Details:      
 
Weak hits

Sequence:  Aquca_009_01099.1|PACid:22033977
Domain Number - Region: 382-418
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0173
Family Anti-platelet protein 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_009_01099.1|PACid:22033977
Sequence length 849
Sequence
MKPRRQTWLSVVMFFFFYSSTSLTHLYCFAADTISLRQSLTFNQTLISKGGKFELGYFTP
SADNSLNYYYYIGIWYKDVSVRNKTVVWVANRDTPLTGDDLTSSELKLLENGILALFYQL
RIVWSSTDQSTSNAIVSSKAVLRDDGNLVLMRTGVRPSDIIWQSFDYPTDTLLPGAKLGY
DITTKKVFSLTSWRSPHDPAKGLYSGQLDRYGDELFIQSKEKNNRSWSSGRWNGEIFSLV
PEMRLVYNLNYRYVKNENESYFTYYVYNSSIPFRLVMDFSGQIKHFEWVESSQSWNLFWS
QPLQYPCEVYGYCSGPFSVCDQDNLPLCRCLNGFIPESPNEWNLSAYSHGCVRNTYLQCG
DEVGFLQDYQQFGFFNQRSYDAIKTTDECKQFCLDDCSCNAYSFNSSCLLWKRDVFARQP
LQEYEGQPPLHIQLRVAGTEILRPTSETRRQTSGGQKPLKAYIIVLIAGSIFVGIFSCSL
FAYKRKQIGKLIFETTETSLADLSRSVEPHEPEQGKLELPLFDFNTVATATNNFSNKLGQ
GGFGSVYKGKLLDEREIAVKRLSTSSGQGEQEFKNELMLISKLQHRNLVRLLGYCISRKE
KILLYEYMPNKSLDAFLFDPTKRNLLDWSKRFSIIDGIARGLLYLHRDSRLKVIHRDLKA
SNVLLDEDMNPKISDFGMARIFGGKQTLANTNRVVGTYGYMSPEYAMEGIFSEKSDVFSF
GVLLLEIVTSKKNTNFYLLEESCNLLGYVYQKYRNENNLLDIMDPTLVESYNSQELMRCI
HIGLLCVQDHAVDRPTMSAVVSMLGSEGTLPLPKQPAFTIERKQFSDIFFNSSDAVSLNS
VTITNPEGR
Download sequence
Identical sequences A0A2G5EGS4
Aquca_009_01099.1|PACid:22033977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]