SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00076.1|PACid:22047500 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00076.1|PACid:22047500
Domain Number 1 Region: 854-1051,1120-1163
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4e-37
Family Pyruvate phosphate dikinase, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00076.1|PACid:22047500
Sequence length 1164
Sequence
MASSSQFTSNTQIPLVHQYALGEGMLLQVKVYKSSYDSNVKVELQLRNCSKLFLLHWGAI
YCGQTNWVLPADRPVGTKLFKQYALQTPFVKSGDVFFITIELRDPKIHAIEFVLKDERHD
KWLKLNQQNFQIKIPEGVKIYSHTSIPKDLVERKAYFLWESMGRPRNSPQQQQENYEIAL
RDLQSQLSKGISLNELQSSFQAPGTKRAADNKESSSVVDNVTSSSYHRRHDVGQWLHQRS
QGKAKISNSLSLGGVGNGIVKWLLDEISQKEKDAERSLMHRFNIATELTERCKSEGELGL
IGIMVWLRFMACRHLTWNKNYNVKPREISTAQDKFTNLLQRIYSSQPNDREIVRLIMTTI
GRGGQGDVGQRIRDEILVLQRNNDCKGGMMEEWHQKLHNNSSPDDVIICQALLDYVRSDF
KIDIYWRTLNANGLTKSILRSYDRPIVSEPHFRVGSKEGLLRDLTSYLKTLKAVHTGADL
ESAIETFLGYSSQGNHFMKAVRVNIVGDVPSRLQECLSFVKMHVDDKNIGPLMEKLLESR
VVLRPLLLTSHEKLKDVIFLDLALDSAVRTTMERGLQELGNTHVPGIVFFISVMLQNLCL
STVGNEQLIYCTKDWYIVSDSYRPNDEQWALQAKAVIDRVRLALSDKSQDYHKMIQPSAQ
YLGNMLRVEKWAIDIFTEELTRAGSAATLSLLVNRLDPILRKIANLGCWQIISPVEVCGL
VTAVSELIIVQTKVYAKPTIIIANKVTGEEEIPDGVVGVLTPDMPDVLSHVSVRARNSKV
CFATCFDQSILKNLKLKEGKMISIKLSSTNLVISDISSSDMSKAHFVTSPIPRGTTLTRK
TFGGKYALAVEEFTVAMVGAKSRNLQHLRGRVPSWIKIPTSVAIPFGVFETLLTSDLNKD
LSNKVSSFSRLVNGGDLSKLLSIQEIILQMKPSSQLINDLRSKMKSSRIPWPGDEGVERW
NQGWLAIKKVWASKWNQRAFISCRKANINHDHVCMSVLIQEVISADYAFVIHTRNPSSGD
SSEIYTEIVKGLGETLVGAYAGRAMSFIVKKSDLKSPIIHGYPSKQIGLYIKKSLIFRSD
SNAEDLEGYAGAGLYDSVPMDKEQKVVLDYSNDRLIKDKGFQRALFSKIAEVGKIIEDLY
RSAQDIEGVVKDGEIYVVQTRPQM
Download sequence
Identical sequences A0A2G5E887
Aquca_010_00076.1|PACid:22047500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]