SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00076.2|PACid:22047501 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00076.2|PACid:22047501
Domain Number 1 Region: 830-1027,1096-1139
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.88e-37
Family Pyruvate phosphate dikinase, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00076.2|PACid:22047501
Sequence length 1140
Sequence
MLLQVKVYKSSYDSNVKVELQLRNCSKLFLLHWGAIYCGQTNWVLPADRPVGTKLFKQYA
LQTPFVKSGDVFFITIELRDPKIHAIEFVLKDERHDKWLKLNQQNFQIKIPEGVKIYSHT
SIPKDLVERKAYFLWESMGRPRNSPQQQQENYEIALRDLQSQLSKGISLNELQSSFQAPG
TKRAADNKESSSVVDNVTSSSYHRRHDVGQWLHQRSQGKAKISNSLSLGGVGNGIVKWLL
DEISQKEKDAERSLMHRFNIATELTERCKSEGELGLIGIMVWLRFMACRHLTWNKNYNVK
PREISTAQDKFTNLLQRIYSSQPNDREIVRLIMTTIGRGGQGDVGQRIRDEILVLQRNND
CKGGMMEEWHQKLHNNSSPDDVIICQALLDYVRSDFKIDIYWRTLNANGLTKSILRSYDR
PIVSEPHFRVGSKEGLLRDLTSYLKTLKAVHTGADLESAIETFLGYSSQGNHFMKAVRVN
IVGDVPSRLQECLSFVKMHVDDKNIGPLMEKLLESRVVLRPLLLTSHEKLKDVIFLDLAL
DSAVRTTMERGLQELGNTHVPGIVFFISVMLQNLCLSTVGNEQLIYCTKDWYIVSDSYRP
NDEQWALQAKAVIDRVRLALSDKSQDYHKMIQPSAQYLGNMLRVEKWAIDIFTEELTRAG
SAATLSLLVNRLDPILRKIANLGCWQIISPVEVCGLVTAVSELIIVQTKVYAKPTIIIAN
KVTGEEEIPDGVVGVLTPDMPDVLSHVSVRARNSKVCFATCFDQSILKNLKLKEGKMISI
KLSSTNLVISDISSSDMSKAHFVTSPIPRGTTLTRKTFGGKYALAVEEFTVAMVGAKSRN
LQHLRGRVPSWIKIPTSVAIPFGVFETLLTSDLNKDLSNKVSSFSRLVNGGDLSKLLSIQ
EIILQMKPSSQLINDLRSKMKSSRIPWPGDEGVERWNQGWLAIKKVWASKWNQRAFISCR
KANINHDHVCMSVLIQEVISADYAFVIHTRNPSSGDSSEIYTEIVKGLGETLVGAYAGRA
MSFIVKKSDLKSPIIHGYPSKQIGLYIKKSLIFRSDSNAEDLEGYAGAGLYDSVPMDKEQ
KVVLDYSNDRLIKDKGFQRALFSKIAEVGKIIEDLYRSAQDIEGVVKDGEIYVVQTRPQM
Download sequence
Identical sequences A0A2G5E869
Aquca_010_00076.2|PACid:22047501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]