SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00137.2|PACid:22046671 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00137.2|PACid:22046671
Domain Number 1 Region: 4-237
Classification Level Classification E-value
Superfamily 14-3-3 protein 3.53e-105
Family 14-3-3 protein 0.00000000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00137.2|PACid:22046671
Sequence length 240
Sequence
MATAREENVYMAKLAEQAERYEEMVEFMEKVTASVEAEELTVEERNLLSVAYKNVIGARR
ASWRIISSIEQKEESRGNEDHVAAIRDYRSKIETELTSICDGILRLLDTRLIPSASAGDS
KVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKSAQDIATAELAPTHPIRLGLALNF
SVFYYEILNSPDRACSLAKQAFDEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQV
Download sequence
Identical sequences A0A2G5E8G3
Aquca_010_00137.2|PACid:22046671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]