SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00137.3|PACid:22046672 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00137.3|PACid:22046672
Domain Number 1 Region: 4-204
Classification Level Classification E-value
Superfamily 14-3-3 protein 4.71e-86
Family 14-3-3 protein 0.0000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00137.3|PACid:22046672
Sequence length 217
Sequence
MATAREENVYMAKLAEQAERYEEMVEFMEKVTASVEAEELTVEERNLLSVAYKNVIGARR
ASWRIISSIEQKEESRGNEDHVAAIRDYRSKIETELTSICDGILRLLDTRLIPSASAGDS
KVFYLKMKGDYHRYLAEFKTGAERKEAAESTLSAYKSAQDIATAELAPTHPIRLGLALNF
SVFYYEILNSPDRACSLAKQPLRSWTPWERNPTRIAL
Download sequence
Identical sequences A0A2G5E8G0
Aquca_010_00137.3|PACid:22046672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]