SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00149.1|PACid:22046359 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00149.1|PACid:22046359
Domain Number 1 Region: 82-189
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.82e-26
Family Canonical RBD 0.0028
Further Details:      
 
Weak hits

Sequence:  Aquca_010_00149.1|PACid:22046359
Domain Number - Region: 40-75
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0225
Family Myosin rod fragments 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00149.1|PACid:22046359
Sequence length 220
Sequence
MEEEEHEVYGGDIPEEGDMDDHNAADVDMTRVDEDVTKLQELDEMKKRLKEMEEEAAALR
EMQAKVEKEMSSVQDPANAAATQANKEEVDSRSVFVGNVDYACTPEEVQQHFQSCGTVNR
VTILTNKVGQPKGYAYVEFLELEAVQEALQLNESELHGRQLKVSAKRTNIPGMKQFRPRR
FNPYMGYPYRAPYVPPYFYSPYGYGKVPRFRRPIRYRPYY
Download sequence
Identical sequences A0A2G5E8J9
Aquca_010_00149.1|PACid:22046359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]