SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00169.1|PACid:22046816 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00169.1|PACid:22046816
Domain Number 1 Region: 13-148
Classification Level Classification E-value
Superfamily Caspase-like 0.000000732
Family Caspase catalytic domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00169.1|PACid:22046816
Sequence length 331
Sequence
MYIYIRKMVANNSILCLTIMLMEKKKRMAVLVGCNYPNTPNELHGCINDVLSMRDMLVEH
FGFDLNHIEVLIDAPGSLVMPTGANIRKSLNRMIDQAEPGDVLFFHYSGHGTRIPTNHGF
KHDEAIVPTDLNLITDVDFRQLVNRLPEKSSFTIISDSCHSGGLIDKEKEQIGPSSMNLT
LPISLNRPKNIPFHYILNDLTSLSGIQSSDIGNHLQEIFGNEASAKFHKNKVLQGILGPI
HPDSGILLSGCQANETSADMNPTMEGGKAYGAFSNAVQMVIKENGTGLSNKQLIIKTRNV
LQTQGFDQHPCLYCSDANADKPFLCLPAAMS
Download sequence
Identical sequences A0A2G5E8K7
Aquca_010_00169.1|PACid:22046816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]