SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00181.1|PACid:22046502 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00181.1|PACid:22046502
Domain Number 1 Region: 4-235
Classification Level Classification E-value
Superfamily 14-3-3 protein 2.49e-104
Family 14-3-3 protein 0.0000000167
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00181.1|PACid:22046502
Sequence length 251
Sequence
MEKEKERLVYMARLAEQAERYDEMVDSMKKVARLDVELTVEERNLVSVGYKNVIGARRAS
WRILSSIEQKEEAKGNDQNVRRIRDYRQRVEDELSKICNDILVVIDEHLVPSSSTGESTV
FYYKMKGDYLRYLAEFKSGNERKEVADQSLKAYEAATSTASTDLLPTHPIRLGLALNFSV
FYYEILNSPERACHLAKQAFDEAISELDSLNEDSYKDSTLIMQLLRDNLTLWTSDLPDEG
GESSKAHDTEA
Download sequence
Identical sequences A0A2G5E8M4
Aquca_010_00181.1|PACid:22046502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]