SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00181.2|PACid:22046503 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00181.2|PACid:22046503
Domain Number 1 Region: 4-191
Classification Level Classification E-value
Superfamily 14-3-3 protein 3.4e-81
Family 14-3-3 protein 0.000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00181.2|PACid:22046503
Sequence length 226
Sequence
MEKEKERLVYMARLAEQAERYDEMVDSMKKVARLDVELTVEERNLVSVGYKNVIGARRAS
WRILSSIEQKEEAKGNDQNVRRIRDYRQRVEDELSKICNDILVVIDEHLVPSSSTGESTV
FYYKMKGDYLRYLAEFKSGNERKEVADQSLKAYEAATSTASTDLLPTHPIRLGLALNFSV
FYYEILNSPESPRGFDIFSLLNNSNVFLMWALPNIPQGVSPCQTSI
Download sequence
Identical sequences A0A2G5E988
Aquca_010_00181.2|PACid:22046503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]