SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00207.1|PACid:22047288 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00207.1|PACid:22047288
Domain Number 1 Region: 65-99
Classification Level Classification E-value
Superfamily WW domain 0.00000272
Family WW domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00207.1|PACid:22047288
Sequence length 220
Sequence
MMVSVQESISSNQKKTTTTTDGFENSGINKRKWEGSGGDNYNLLSKISKVETTKSFLDID
FHLEKPLPLDWKQCLDVQSGQIHFYNTKTKKKTCKDPRQSPERLSLTPLSLDLELNLPCN
SLGTHAYDNWTKPTEPDSYLSMNITTSPKNSDALKRCTSWTTFEEDHKEMVAAVCLRCNI
LVMMCKSSPACPNCKFVHPPEQSPISLSKPRFSLLPCKDQ
Download sequence
Identical sequences A0A2G5E8S8
Aquca_010_00207.1|PACid:22047288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]