SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Aquca_010_00212.1|PACid:22046448 from Aquilegia coerulea v195

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Aquca_010_00212.1|PACid:22046448
Domain Number 1 Region: 25-121
Classification Level Classification E-value
Superfamily POZ domain 8.63e-18
Family BTB/POZ domain 0.0088
Further Details:      
 
Weak hits

Sequence:  Aquca_010_00212.1|PACid:22046448
Domain Number - Region: 518-557
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0889
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Aquca_010_00212.1|PACid:22046448
Sequence length 607
Sequence
MKKSLQANTSQCVAIVEKFEKKERSWFPTSQIPTDLIIHVQDINFYVHKLPLISKSECLS
DLLKSRPSQSNSSCDIKLDNFPGGAETFELIIKFCYGFSVDLTASNVAPVRCAAEFLQMT
EEYEEGNLISKTESFIAFIVLSSWRDSITVMKSCECLSTWAENLQILRKCTDAVALKIIR
RTSMCNDTDYDGERWWFDDISILCIDHFVRIITAIRAKGSKPEIIGASIMHYAEKWLPGM
EELQGQKGFGHRKNELHMTILSGKWEEGNVGQEKEQRRMIEVLVSILPPQREAVPCKFLL
SMLKMALVYTATTALVSELEKRVGMVLGDATVYDLLIPIPSYNNGTEGKLGSPSEERRTM
HDVDTIQRIVEYFLMHEQQLQQQQSNVGKLLDGYLTEIARDPNLSIAKFQALAEVLPQDA
RTCHDGLYRAIDTYLKTHPTLMEHDRRRLCKPMDCEKLSLDGCMHAAQNDRLPLRTVMQV
TFSYKVLYSEQIKMRAAMNGKGPMQHDIMCEQDSTWSTKKEIKNIISELQKIRTSIEELQ
HDYSQLQQEFEKANKQKIVSGWSSGWKKFKTSTLFHGKMNAMDTENVQLGQTTVSSKNSR
RRRKSIS
Download sequence
Identical sequences A0A2G5E8Z3
Aquca_010_00212.1|PACid:22046448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]